PDB entry 4jp6

View 4jp6 on RCSB PDB site
Description: High resolution structure of a papaya barwin-like protein
Class: unknown function
Keywords: pathogenesis-related protein of family 4, barwin family, double-psi beta barrel, Unknown Function
Deposited on 2013-03-19, released 2013-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: papaya barwin-like protein
  Species: CARICA PAPAYA [TaxId:3649]
  Database cross-references and differences (RAF-indexed):
  • PDB 4JP6 (0-121)
  Domains in SCOPe 2.08: d4jp6a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4jp6A (A:)
  esasnvratyhfynaqqngwdlrkvsaycatwdadkpyswrskygwtafcgpvgphgraa
  cgkclrvtntktraettvrivdqcsnggldldwsvfkkldtdgsgylrghlivnyqfvnc
  gn