PDB entry 4jp1

View 4jp1 on RCSB PDB site
Description: Mg2+ bound structure of Vibrio Cholerae CheY3
Class: signaling protein
Keywords: Response regulator, signal transduction, motor protein FliM, SIGNALING PROTEIN
Deposited on 2013-03-19, released 2014-04-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.235
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY
    Species: Vibrio cholerae [TaxId:345073]
    Gene: cheY-3, VC0395_A1653, VC395_2180
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5F6J9 (1-123)
      • expression tag (0)
    Domains in SCOPe 2.05: d4jp1a_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jp1A (A:)
    anknmkilivddfstmrrivknllrdlgfnntqeaddgltalpmlkkgdfdfvvtdwnmp
    gmqgidllkniradeelkhlpvlmitaeakreqiieaaqagvngyivkpftaatlkekld
    kife