PDB entry 4jo5

View 4jo5 on RCSB PDB site
Description: CBM3a-L domain with flanking linkers from scaffoldin cipA of cellulosome of Clostridium thermocellum
Class: cellulose binding protein
Keywords: CBM, scaffolding, cellulose binding, beta sandwich, thermophile, CipA module, CELLULOSE BINDING PROTEIN
Deposited on 2013-03-16, released 2013-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.174
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulosome anchoring protein cohesin region
    Species: CLOSTRIDIUM THERMOCELLUM [TaxId:1094188]
    Gene: CIPA, YSBL_2973
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jo5a_
  • Heterogens: CA, GOL, SO4, CL, 1MZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jo5A (A:)
    vptntptntpantpvsgnlkvefynsnpsdttnsinpqfkvtntgssaidlskltlryyy
    tvdgqkdqtfwcdhaaiigsngsyngitsnvkgtfvkmssstnnadtyleisftggtlep
    gahvqiqgrfakndwsnytqsndysfksasqfvewdqvtaylngvlvwgkepggsvvpst
    qpvttppatt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jo5A (A:)
    ntpvsgnlkvefynsnpsdttnsinpqfkvtntgssaidlskltlryyytvdgqkdqtfw
    cdhaaiigsngsyngitsnvkgtfvkmssstnnadtyleisftggtlepgahvqiqgrfa
    kndwsnytqsndysfksasqfvewdqvtaylngvlvwgkepggsvvpstq