PDB entry 4jnj

View 4jnj on RCSB PDB site
Description: Structure based engineering of streptavidin monomer with a reduced biotin dissociation rate
Class: protein binding
Keywords: Beta barrel, Engineered Streptavidin Variant, Biotin, Biotin-Binding Protein, PROTEIN BINDING
Deposited on 2013-03-15, released 2013-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Streptavidin/Rhizavidin Hybrid
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JNJ (0-114)
    Domains in SCOPe 2.07: d4jnja_
  • Chain 'B':
    Compound: Streptavidin/Rhizavidin Hybrid
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JNJ (0-End)
    Domains in SCOPe 2.07: d4jnjb_
  • Chain 'C':
    Compound: Streptavidin/Rhizavidin Hybrid
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JNJ (Start-114)
    Domains in SCOPe 2.07: d4jnjc_
  • Chain 'D':
    Compound: Streptavidin/Rhizavidin Hybrid
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JNJ (Start-114)
    Domains in SCOPe 2.07: d4jnjd_
  • Heterogens: BTN, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jnjA (A:)
    gaeagitgtwynqsgstftvtagadgnltgqyenraqgtgcqnspytltgryngtklewr
    vewnnstenchsrtewrgqyqggaearintqwnltyeggsgpateqgqdtftkvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jnjB (B:)
    gaeagitgtwynqsgstftvtagadgnltgqyenraqgtgcqnspytltgryngtklewr
    vewnnstenchsrtewrgqyqggaearintqwnltyeggsgpateqgqdtftkvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jnjB (B:)
    gaeagitgtwynqsgstftvtagadgnltgqyenraqgtgcqnspytltgryngtklewr
    vewnnstenchsrtewrgqyqggaearintqwnltyeggsgpateqgqdtftkv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4jnjC (C:)
    gaeagitgtwynqsgstftvtagadgnltgqyenraqgtgcqnspytltgryngtklewr
    vewnnstenchsrtewrgqyqggaearintqwnltyeggsgpateqgqdtftkvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jnjC (C:)
    gitgtwynqsgstftvtagadgnltgqyenraqgtgcqnspytltgryngtklewrvewn
    nstenchsrtewrgqyqggaearintqwnltyeggsgpateqgqdtftkvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4jnjD (D:)
    gaeagitgtwynqsgstftvtagadgnltgqyenraqgtgcqnspytltgryngtklewr
    vewnnstenchsrtewrgqyqggaearintqwnltyeggsgpateqgqdtftkvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jnjD (D:)
    eagitgtwynqsgstftvtagadgnltgqyenraqgtgcqnspytltgryngtklewrve
    wnnstenchsrtewrgqyqggaearintqwnltyeggsgpateqgqdtftkvk