PDB entry 4jnf

View 4jnf on RCSB PDB site
Description: Allosteric opening of the polypeptide-binding site when an Hsp70 binds ATP
Class: chaperone
Keywords: DnaK, Chaperone, 70kDa heat shock protein (Hsp70), Substrate Binding Domain (SBD)
Deposited on 2013-03-15, released 2013-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hsp70 CHAPERONE DnaK
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6Y8 (1-End)
      • expression tag (0)
      • engineered mutation (40-42)
    Domains in SCOPe 2.07: d4jnfa1, d4jnfa2, d4jnfa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jnfA (A:)
    svllldvtplslgietmggvmttliaknttiptkhsqvfsmggavtihvlqgerkraadn
    kslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassglnede
    iqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaiesalta
    letalkgedkaaieakmqelaqvsqklmeiaqqqhaqqqha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jnfA (A:)
    svllldvtplslgietmggvmttliaknttiptkhsqvfsmggavtihvlqgerkraadn
    kslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassglnede
    iqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaiesalta
    letalkgedkaaieakmqelaqvsqklmeiaqq