PDB entry 4jnc

View 4jnc on RCSB PDB site
Description: Soluble Epoxide Hydrolase complexed with a carboxamide inhibitor
Class: Hydrolase/hydrolase inhibitor
Keywords: epoxide hydrolase, Hydrolase-hydrolase inhibitor complex
Deposited on 2013-03-15, released 2013-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.188
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional epoxide hydrolase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHX2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P34913 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d4jnca1, d4jnca2
  • Heterogens: 1LF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jncA (A:)
    gshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgy
    gessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervrava
    slntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesv
    lsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwa
    ckslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnq
    ilikwldsdarnpad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jncA (A:)
    gshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgy
    gessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervrava
    slntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesv
    lsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwa
    ckslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnq
    ilikwldsdarn