PDB entry 4jmi

View 4jmi on RCSB PDB site
Description: Sec7 domain of ARNO, an exchange factor, at 1.5 Angstrom resolution
Class: signaling protein
Keywords: Nucleotide Exchange Factors, Arf1, SIGNALING PROTEIN
Deposited on 2013-03-14, released 2013-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.135
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytohesin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: CYTH2, ARNO, PSCD2, PSCD2L
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99418 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d4jmia1, d4jmia2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jmiA (A:)
    gshmsktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktai
    gdylgereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqry
    clcnpgvfqstdtcyvlsfavimlntslhnpnvrdkpglerfvamnrgineggdlpeell
    rnlydsirnepfkipeddgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jmiA (A:)
    hmsktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigd
    ylgereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqrycl
    cnpgvfqstdtcyvlsfavimlntslhnpnvrdkpglerfvamnrgineggdlpeellrn
    lydsirnepfki