PDB entry 4jlh

View 4jlh on RCSB PDB site
Description: HIV-1 Integrase Catalytic Core Domain A128T Mutant Complexed with Allosteric Inhibitor
Class: transferase/transferase inhibitor
Keywords: Integrase, CCD, DDE motif, drug resistance, A128T mutation, dimer interface, allosteric inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-03-12, released 2013-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HIV-1 Integrase catalytic core domain
    Species: Human immunodeficiency virus type 1 [TaxId:11698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497
      • engineered mutation (78)
      • engineered mutation (135)
    Domains in SCOPe 2.08: d4jlha_
  • Heterogens: 0L9, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4jlhA (A:)
mhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwp
vktvhtdngsnftsttvktacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqa
ehlktavqmavfihnkkrkggiggysagerivdiiatdiqtke

    Sequence, based on observed residues (ATOM records): (download) 
    >4jlhA (A:)
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvktacwwagikqefesmnkelkkiigqvrdqaehlktavqmavfihnkkr
kgggysagerivdiiatdiq