PDB entry 4jlg

View 4jlg on RCSB PDB site
Description: SETD7 in complex with inhibitor (R)-PFI-2 and S-adenosyl-methionine
Class: transferase/transferase inhibitor
Keywords: Methyltransferase, SET domain, histone modification, transcription regulation, histone lysine methyltransferase, inhibitor, S-adenosyl-L-methionine, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-03-12, released 2013-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-18, with a file datestamp of 2015-02-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.212
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-lysine N-methyltransferase SETD7
    Species: Homo sapiens [TaxId:9606]
    Gene: SETD7, KIAA1717, KMT7, SET7, SET9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jlga1, d4jlga2
  • Chain 'B':
    Compound: Histone-lysine N-methyltransferase SETD7
    Species: Homo sapiens [TaxId:9606]
    Gene: SETD7, KIAA1717, KMT7, SET7, SET9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jlgb1, d4jlgb2
  • Heterogens: SAM, 1L8, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jlgA (A:)
    qykdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegk
    latlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissage
    glfskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskyc
    aslghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgpe
    apewyqvelkafqatqqkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jlgA (A:)
    gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste
    egrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskvav
    gpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycaslghkan
    hsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgpeapewyqve
    lkafqat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jlgB (B:)
    qykdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegk
    latlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissage
    glfskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskyc
    aslghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgpe
    apewyqvelkafqatqqkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jlgB (B:)
    vcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmstee
    grphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskvavg
    pntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycaslghkanh
    sftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgpeapewyqvel
    kafqat