PDB entry 4jko

View 4jko on RCSB PDB site
Description: Crystal structure of a catalytic mutant of Axe2 (Axe2_S15A), an acetylxylan esterase from Geobacillus stearothermophilus
Class: Hydrolase
Keywords: SGNH hydrolase fold, Acetylxylan Esterase, Hydrolase, Catalytic mutant
Deposited on 2013-03-11, released 2014-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.151
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl xylan esterase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: axe2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q09LX1 (0-218)
      • engineered mutation (14)
    Domains in SCOPe 2.06: d4jkoa_
  • Chain 'B':
    Compound: acetyl xylan esterase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: axe2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q09LX1 (0-218)
      • engineered mutation (14)
    Domains in SCOPe 2.06: d4jkob_
  • Heterogens: GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jkoA (A:)
    mkigsgekllfigdaitdcgrarpegegsfgalgtgyvayvvgllqavypelgirvvnkg
    isgntvrdlkarweedviaqkpdwvsimigindvwrqydlpfmkekhvyldeyeatlrsl
    vletkplvkgiilmtpfyiegneqdpmrrtmdqygrvvkqiaeetnslfvdtqaafnevl
    ktlypaalawdrvhpsvaghmilaraflreigfewvrsr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jkoB (B:)
    mkigsgekllfigdaitdcgrarpegegsfgalgtgyvayvvgllqavypelgirvvnkg
    isgntvrdlkarweedviaqkpdwvsimigindvwrqydlpfmkekhvyldeyeatlrsl
    vletkplvkgiilmtpfyiegneqdpmrrtmdqygrvvkqiaeetnslfvdtqaafnevl
    ktlypaalawdrvhpsvaghmilaraflreigfewvrsr