PDB entry 4jit

View 4jit on RCSB PDB site
Description: Crystal Structure of E. coli XGPRT in complex with (S)-3-(Guanin-9-yl)pyrrolidin-N-ylacetylphosphonic acid
Class: transferase
Keywords: xanthine-guanine phosphoribosyltransferase, purine salvage, nucleoside phosphonate, antibacterial, transferase
Deposited on 2013-03-07, released 2014-12-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.213
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xanthine phosphoribosyltransferase
    Species: Escherichia coli [TaxId:1110693]
    Gene: gpt, ECMDS42_0227
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jita_
  • Chain 'B':
    Compound: Xanthine phosphoribosyltransferase
    Species: Escherichia coli [TaxId:1110693]
    Gene: gpt, ECMDS42_0227
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jitb_
  • Chain 'C':
    Compound: Xanthine phosphoribosyltransferase
    Species: Escherichia coli [TaxId:1110693]
    Gene: gpt, ECMDS42_0227
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jitc_
  • Chain 'D':
    Compound: Xanthine phosphoribosyltransferase
    Species: Escherichia coli [TaxId:1110693]
    Gene: gpt, ECMDS42_0227
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jitd_
  • Heterogens: 3ZF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jitA (A:)
    msekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvci
    ssydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrp
    lvddyvvdipqdtwieqpwdmgvvfvppisgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jitA (A:)
    ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvciss
    ydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrplv
    ddyvvdipqdtwieqpwdmgvvfvppisg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jitB (B:)
    msekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvci
    ssydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrp
    lvddyvvdipqdtwieqpwdmgvvfvppisgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jitB (B:)
    ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvciss
    ydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrplv
    ddyvvdipqdtwieqpwdmgvvfvppisgr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4jitC (C:)
    msekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvci
    ssydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrp
    lvddyvvdipqdtwieqpwdmgvvfvppisgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jitC (C:)
    ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvciss
    ydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrplv
    ddyvvdipqdtwieqpwdmgvvfvppisgr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4jitD (D:)
    msekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvci
    ssydhdnqrelkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrp
    lvddyvvdipqdtwieqpwdmgvvfvppisgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jitD (D:)
    ekyivtwdmlqiharklasrlmpseqwkgiiavsrgglvpgallarelgirhvdtvcise
    lkvlkraegdgegfividdlvdtggtavairemypkahfvtifakpagrplvddyvvdip
    qdtwieqpwdmgvvfvppisgr