PDB entry 4jik

View 4jik on RCSB PDB site
Description: X-RAY Crystal structure of compound 22a (R)-2-(4-chlorophenyl)-8-(piperidin-3-ylamino)imidazo[1,2-c]pyrimidine-5-carboxamide bound to human chk1 kinase domain
Class: transferase/transferase inhibitor
Keywords: KINASE PHOSPHATASE TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-03-06, released 2013-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.211
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHEK1, CHK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jika_
  • Heterogens: 1KO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jikA (A:)
    avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
    lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
    hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
    refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
    lhkilvenpsaritipdikkdrwynkplkkgak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jikA (A:)
    pfvedwdlvqtlgegagevqlavnrvteeavavkivnikkeicinkmlnhenvvkfyghr
    reiqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithrdikpenl
    llderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepvdvwscgi
    vltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilvenpsariti
    pdikkdrwynkplkkg