PDB entry 4jht

View 4jht on RCSB PDB site
Description: Crystal Structure of AlkB in complex with 5-carboxy-8-hydroxyquinoline (IOX1)
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: double-stranded beta helix, jelly-roll motif, oxidoreductase, dioxygenase, Nucleic acid demethylase, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2013-03-05, released 2013-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: N/A
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-ketoglutarate-dependent dioxygenase AlkB
    Species: Escherichia coli [TaxId:83333]
    Gene: aidD, alkB, b2212, JW2200
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jhta_
  • Heterogens: 8XQ, MN, ACT, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jhtA (A:)
    mqeplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwt
    thrqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklsl
    hqdkdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiq
    plkagfhpltidcrynltfrqagkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jhtA (A:)
    plaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthr
    qgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqd
    kdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplk
    agfhpltidcrynltfrqagk