PDB entry 4jhq

View 4jhq on RCSB PDB site
Description: Crystal structure of avidin - 6-(6-biotinamidohexanamido)hexanoylferrocene complex
Class: Biotin-binding protein
Keywords: Beta barrel, Biotin-binding protein, 6-(6-biotinamidohexanamido)hexanoylferrocene, Glycoprotein, Hen egg white
Deposited on 2013-03-05, released 2013-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.165
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • see remark 999 (25)
      • see remark 999 (33)
    Domains in SCOPe 2.07: d4jhqa_
  • Chain 'B':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • see remark 999 (25)
      • see remark 999 (33)
    Domains in SCOPe 2.07: d4jhqb_
  • Heterogens: B6F, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jhqA (A:)
    arkcsltgkwtndlgsnmtigavnskgeftgtyttavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jhqA (A:)
    rkcsltgkwtndlgsnmtigavnskgeftgtyttavtatsneikesplhgtqntinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rlrt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jhqB (B:)
    arkcsltgkwtndlgsnmtigavnskgeftgtyttavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jhqB (B:)
    rkcsltgkwtndlgsnmtigavnskgeftgtyttavtatsneikesplhgtqntinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rlr