PDB entry 4jhf

View 4jhf on RCSB PDB site
Description: Crystal Structure of Translin
Class: DNA binding protein
Keywords: All Alpha Proteins, iRNA, microRNA, RNA, DNA BINDING PROTEIN
Deposited on 2013-03-05, released 2014-05-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.208
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translin
    Species: Homo sapiens [TaxId:9606]
    Gene: Translin, TSN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jhfa_
  • Chain 'B':
    Compound: Translin
    Species: Homo sapiens [TaxId:9606]
    Gene: Translin, TSN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jhfb_
  • Chain 'C':
    Compound: Translin
    Species: Homo sapiens [TaxId:9606]
    Gene: Translin, TSN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15631 (12-End)
      • expression tag (11)
    Domains in SCOPe 2.06: d4jhfc1, d4jhfc2
  • Chain 'D':
    Compound: Translin
    Species: Homo sapiens [TaxId:9606]
    Gene: Translin, TSN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15631 (12-End)
      • expression tag (10-11)
    Domains in SCOPe 2.06: d4jhfd1, d4jhfd2
  • Chain 'E':
    Compound: Translin
    Species: Homo sapiens [TaxId:9606]
    Gene: Translin, TSN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15631 (12-End)
      • expression tag (11)
    Domains in SCOPe 2.06: d4jhfe1, d4jhfe2
  • Chain 'F':
    Compound: Translin
    Species: Homo sapiens [TaxId:9606]
    Gene: Translin, TSN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15631 (12-End)
      • expression tag (11)
    Domains in SCOPe 2.06: d4jhff1, d4jhff2
  • Chain 'G':
    Compound: Translin
    Species: Homo sapiens [TaxId:9606]
    Gene: Translin, TSN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jhfg_
  • Chain 'H':
    Compound: Translin
    Species: Homo sapiens [TaxId:9606]
    Gene: Translin, TSN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jhfh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jhfA (A:)
    mrgshhhhhhgsmsvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqg
    agfqdipkrclkarehfgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyl
    etetlvtreavteilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrpl
    histfineldsgfrllnlkndslrkrydglkydvkkveevvydlsirgfnketaaacvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jhfA (A:)
    msvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqgdipkrclkareh
    fgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavteilg
    iepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsgfrll
    nlkndslrkrydglkydvkkveevvydlsirgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jhfB (B:)
    mrgshhhhhhgsmsvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqg
    agfqdipkrclkarehfgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyl
    etetlvtreavteilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrpl
    histfineldsgfrllnlkndslrkrydglkydvkkveevvydlsirgfnketaaacvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jhfB (B:)
    msvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqdipkrclkarehf
    gtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavteilgi
    epdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsgfrlln
    lkndslrkrydglkydvkkveevvydlsirgf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4jhfC (C:)
    mrgshhhhhhgsmsvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqg
    agfqdipkrclkarehfgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyl
    etetlvtreavteilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrpl
    histfineldsgfrllnlkndslrkrydglkydvkkveevvydlsirgfnketaaacvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jhfC (C:)
    smsvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqgadipkrclkar
    ehfgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavtei
    lgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsgfr
    llnlkndslrkrydglkydvkkveevvydlsirg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4jhfD (D:)
    mrgshhhhhhgsmsvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqg
    agfqdipkrclkarehfgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyl
    etetlvtreavteilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrpl
    histfineldsgfrllnlkndslrkrydglkydvkkveevvydlsirgfnketaaacvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jhfD (D:)
    gsmsvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqfqdipkrclka
    rehfgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavte
    ilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsgf
    rllnlkndslrkrydglkydvkkveevvydlsirgf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4jhfE (E:)
    mrgshhhhhhgsmsvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqg
    agfqdipkrclkarehfgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyl
    etetlvtreavteilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrpl
    histfineldsgfrllnlkndslrkrydglkydvkkveevvydlsirgfnketaaacvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jhfE (E:)
    smsvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqdipkrclkareh
    fgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavteilg
    iepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsgfrll
    nlkndslrkrydglkydvkkveevvydlsirgf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4jhfF (F:)
    mrgshhhhhhgsmsvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqg
    agfqdipkrclkarehfgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyl
    etetlvtreavteilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrpl
    histfineldsgfrllnlkndslrkrydglkydvkkveevvydlsirgfnketaaacvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jhfF (F:)
    smsvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhdipkrclkarehf
    gtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavteilgi
    epdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsgfrlln
    lkndslrkrydglkydvkkveevvydlsirgf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4jhfG (G:)
    mrgshhhhhhgsmsvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqg
    agfqdipkrclkarehfgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyl
    etetlvtreavteilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrpl
    histfineldsgfrllnlkndslrkrydglkydvkkveevvydlsirgfnketaaacvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jhfG (G:)
    msvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqdipkrclkarehf
    gtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavteilgi
    epdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsgfrlln
    lkndslrkrydglkydvkkveevvydlsirgf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4jhfH (H:)
    mrgshhhhhhgsmsvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqg
    agfqdipkrclkarehfgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyl
    etetlvtreavteilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrpl
    histfineldsgfrllnlkndslrkrydglkydvkkveevvydlsirgfnketaaacvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jhfH (H:)
    msvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhdipkrclkarehfg
    tvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavteilgie
    pdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsgfrllnl
    kndslrkrydglkydvkkveevvydlsirg