PDB entry 4jhc

View 4jhc on RCSB PDB site
Description: Crystal structure of the uncharacterized Maf protein YceF from E. coli
Class: cell cycle
Keywords: Maf protein, putative pyrophosphatase, CELL CYCLE
Deposited on 2013-03-04, released 2013-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maf-like protein YceF
    Species: Escherichia coli [TaxId:83333]
    Gene: yceF, b1087, JW5155
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jhca_
  • Chain 'B':
    Compound: Maf-like protein YceF
    Species: Escherichia coli [TaxId:83333]
    Gene: yceF, b1087, JW5155
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jhcb_
  • Heterogens: GOL, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jhcA (A:)
    mgsshhhhhhssgrenlyfqgmpklilastspwrralleklqisfecaapevdetprsde
    sprqlvlrlaqekaqslasrypdhliigsdqvcvldgeitgkplteenarlqlrkasgni
    vtfytglalfnsanghlqtevepfdvhfrhlseaeidnyvrkehplhcagsfksegfgit
    lferlegrdpntlvglplialcqmlrregknplmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jhcA (A:)
    pklilastspwrralleklqisfecaapevdetprsdesprqlvlrlaqekaqslasryp
    dhliigsdqvcvldgeitgkplteenarlqlrkasgnivtfytglalfnsanghlqteve
    pfdvhfrhlseaeidnyvrkehplhcagsfksegfgitlferlegrdpntlvglplialc
    qmlrregknplm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jhcB (B:)
    mgsshhhhhhssgrenlyfqgmpklilastspwrralleklqisfecaapevdetprsde
    sprqlvlrlaqekaqslasrypdhliigsdqvcvldgeitgkplteenarlqlrkasgni
    vtfytglalfnsanghlqtevepfdvhfrhlseaeidnyvrkehplhcagsfksegfgit
    lferlegrdpntlvglplialcqmlrregknplmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jhcB (B:)
    pklilastspwrralleklqisfecaapevdetprsdesprqlvlrlaqekaqslasryp
    dhliigsdqvcvldgeitgkpleenarlqlrkasgnivtfytglalfnsanghlqtevep
    fdvhfrhlseaeidnyvrfksegfgitlferlegrdpntlvglplialcqmlrregknpl
    mg