PDB entry 4jhb

View 4jhb on RCSB PDB site
Description: Crystal structure of RelB double mutants: Y300F/I335F
Class: transcription
Keywords: intertwined dimer, non-canonical side-by side dimer, transcription factor, transcription
Deposited on 2013-03-04, released 2013-09-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.195
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor relb
    Species: Mus musculus [TaxId:10090]
    Gene: Relb
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04863 (8-109)
      • expression tag (0-7)
      • engineered mutation (31)
      • engineered mutation (66)
    Domains in SCOPe 2.06: d4jhba1, d4jhba2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4jhbA (A:)
lvprgshmntselricrinkesgpctggeelfllcdkvqkedisvvfstaswegradfsq
advhrqfaivfktppyedleisepvtvnvflqrltdgvcseplpftylpr