PDB entry 4jh7

View 4jh7 on RCSB PDB site
Description: Crystal Structure of FosB from Bacillus cereus with Manganese and L-Cysteine-Fosfomycin Product
Class: transferase
Keywords: Bacillithiol-S-Transferase, TRANSFERASE
Deposited on 2013-03-04, released 2013-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Metallothiol transferase FosB
  Species: Bacillus cereus [TaxId:222523]
  Gene: fosB, BCE_2111
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q739M9 (0-137)
  Domains in SCOPe 2.08: d4jh7a_
• Chain 'B':
  Compound: Metallothiol transferase FosB
  Species: Bacillus cereus [TaxId:222523]
  Gene: fosB, BCE_2111
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q739M9 (0-137)
  Domains in SCOPe 2.08: d4jh7b_
• Heterogens: MN, MG, FMT, 1KM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4jh7A (A:)
  mlnginhlcfsvsnledsiefyekvlegellvrgrklayfnicgvwvalneeihiprnei
  yqsythiafsveqkdfesllqrleendvhilkgrerdvrdcesiyfvdpdghkfefhsgt
  lqdrlnyyredkphmtfy
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4jh7B (B:)
  mlnginhlcfsvsnledsiefyekvlegellvrgrklayfnicgvwvalneeihiprnei
  yqsythiafsveqkdfesllqrleendvhilkgrerdvrdcesiyfvdpdghkfefhsgt
  lqdrlnyyredkphmtfy