PDB entry 4jg1

View 4jg1 on RCSB PDB site
Description: Structure of phosphoserine/threonine (pSTAb) scaffold bound to pThr peptide
Class: immune system
Keywords: immmunoglobulin domain, immune system
Deposited on 2013-02-28, released 2013-08-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.152
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JG1
  • Chain 'L':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JG1 (0-213)
    Domains in SCOPe 2.04: d4jg1l1, d4jg1l2
  • Chain 'P':
    Compound: phosphopeptide
    Database cross-references and differences (RAF-indexed):
    • PDB 4JG1 (Start-11)
  • Heterogens: PPI, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4jg1L (L:)
divltqspatlslspgeratlscmtstdidddmnwyqqkpgqaprllisegntlrpgvpa
rfsgsgsgtdftltisslepedfavyyclqsfnvpltfgqgtkveikrtvaapsvfifpp
sdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrgec

  • Chain 'P':
    No sequence available.