PDB entry 4jfx

View 4jfx on RCSB PDB site
Description: Structure of phosphotyrosine (pTyr) scaffold bound to pTyr peptide
Class: immune system
Keywords: immmunoglobulin domain, immune system
Deposited on 2013-02-28, released 2013-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fab light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 4JFX (0-213)
  Domains in SCOPe 2.07: d4jfxa1, d4jfxa2
• Chain 'B':
  Compound: Fab heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 4JFX (0-End)
• Chain 'H':
  Compound: Fab heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 4JFX
• Chain 'L':
  Compound: Fab light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 4JFX (0-213)
  Domains in SCOPe 2.07: d4jfxl1, d4jfxl2
• Chain 'P':
  Compound: phosphopeptide
  Database cross-references and differences (RAF-indexed):
  • PDB 4JFX (Start-11)
• Heterogens: PG4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4jfxA (A:)
  divltqspatlslspgeratlscmtstdidddmnwyqqkpgqaprllisegntlrpgvpa
  rfsgsgsgtdftltisslepedfavyyclqsfnvpltfgqgtkveikrtvaapsvfifpp
  sdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
  lskadyekhkvyacevthqglsspvtksfnrgec
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4jfxL (L:)
  divltqspatlslspgeratlscmtstdidddmnwyqqkpgqaprllisegntlrpgvpa
  rfsgsgsgtdftltisslepedfavyyclqsfnvpltfgqgtkveikrtvaapsvfifpp
  sdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
  lskadyekhkvyacevthqglsspvtksfnrgec
  

  
  
• Chain 'P':
  No sequence available.