PDB entry 4jfm

View 4jfm on RCSB PDB site
Description: Increasing the Efficiency Efficiency of Ligands for the FK506-Binding Protein 51 by Conformational Control: Complex of FKBP51 with 2-(3,4-dimethoxyphenoxy)ethyl (2S)-1-[(2-oxo-2,3-dihydro-1,3-benzothiazol-6-yl)sulfonyl]piperidine-2-carboxylate
Class: isomerase
Keywords: Fk-506 binding domain, Hsp90 cochaperone, immunophiline, peptidyl-prolyl isomerase, ISOMERASE
Deposited on 2013-02-28, released 2013-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 1.02 Å
R-factor: 0.149
AEROSPACI score: 0.98 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-prolyl cis-trans isomerase FKBP5
  Species: Homo sapiens [TaxId:9606]
  Gene: AIG6, FKBP5, FKBP51
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13451 (3-127)
    • expression tag (0-2)
    • engineered mutation (6)
  Domains in SCOPe 2.07: d4jfma1, d4jfma2
• Heterogens: 1KZ, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4jfmA (A:)
  gapatvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshd
  rnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffei
  elldfkge