PDB entry 4jf1

View 4jf1 on RCSB PDB site
Description: R144Q mutant of N-acetylornithine aminotransferase
Class: transferase
Keywords: PLP dependent fold type I sub class II aminotransferase, TRANSFERASE
Deposited on 2013-02-27, released 2014-03-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: 0.168
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetylornithine/succinyldiaminopimelate aminotransferase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: argD, dapC, dtu, STM3468
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40732 (Start-419)
      • engineered mutation (158)
      • engineered mutation (312)
      • expression tag (420-421)
    Domains in SCOPe 2.07: d4jf1a1, d4jf1a2
  • Chain 'B':
    Compound: Acetylornithine/succinyldiaminopimelate aminotransferase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: argD, dapC, dtu, STM3468
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40732
      • engineered mutation (158)
      • engineered mutation (312)
    Domains in SCOPe 2.07: d4jf1b_
  • Heterogens: PLP, EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jf1A (A:)
    mrgshhhhhhgmashmateqtaitratfdevilpvyapadfipvkgkgsrvwdqqgkeyi
    dfaggiavtalghchpalvealksqgetlwhtsnvftnepalrlgrklidatfaervlfm
    nsgteanetafklarhyacvrhspfktkiiafhnafhgqslftvsvggqpkysdgfgpkp
    adiihvpfndlhavkavmddhtcavvvepiqgeggvqaatpeflkglrdlcdehqallvf
    devqcgmgrtgdlfaymhygvtpdiltsakalgggfpvsamlttqeiasafhvgshgsty
    ggnplacavagatfdiintpevlqgihtkrqqfvqhlqaideqfdifsdirgmglligae
    lkpkykgrardflyagaeagvmvlnagadvmrfapslvveeadihegmqrfaqavgkvva
    le
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jf1A (A:)
    tfdevilpvyapadfipvkgkgsrvwdqqgkeyidfaggiavtalghchpalvealksqg
    etlwhtsnvftnepalrlgrklidatfaervlfmnsgteanetafklarhyacvrhspfk
    tkiiafhnafhgqslftvsvggqpkysdgfgpkpadiihvpfndlhavkavmddhtcavv
    vepiqgeggvqaatpeflkglrdlcdehqallvfdevqcgmgrtgdlfaymhygvtpdil
    tsakalgggfpvsamlttqeiasafstyggnplacavagatfdiintpevlqgihtkrqq
    fvqhlqaideqfdifsdirgmglligaelkpkykgrardflyagaeagvmvlnagadvmr
    fapslvveeadihegmqrfaqavgkvvale
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jf1B (B:)
    mrgshhhhhhgmashmateqtaitratfdevilpvyapadfipvkgkgsrvwdqqgkeyi
    dfaggiavtalghchpalvealksqgetlwhtsnvftnepalrlgrklidatfaervlfm
    nsgteanetafklarhyacvrhspfktkiiafhnafhgqslftvsvggqpkysdgfgpkp
    adiihvpfndlhavkavmddhtcavvvepiqgeggvqaatpeflkglrdlcdehqallvf
    devqcgmgrtgdlfaymhygvtpdiltsakalgggfpvsamlttqeiasafhvgshgsty
    ggnplacavagatfdiintpevlqgihtkrqqfvqhlqaideqfdifsdirgmglligae
    lkpkykgrardflyagaeagvmvlnagadvmrfapslvveeadihegmqrfaqavgkvva
    le
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jf1B (B:)
    lpvyapadfipvkgkgsrvwdqqgkeyidfaggiavtalghchpalvealksqgetlwht
    snvftnepalrlgrklidatfaervlfmnsgteanetafklarhyacvrhspfktkiiaf
    hnafhgqslftvsvggqpkysdgfgpkpadiihvpfndlhavkavmddhtcavvvepiqg
    eggvqaatpeflkglrdlcdehqallvfdevqcgmgrtgdlfaymhygvtpdiltsakal
    gggfpvsamlttqeiasafhvgshgstyggnplacavagatfdiintpevlqgihtkrqq
    fvqhlqaideqfdifsdirgmglligaelkpkykgrardflyagaeagvmvlnagadvmr
    fapslvveeadihegmqrfaqavgkvv