PDB entry 4jf0

View 4jf0 on RCSB PDB site
Description: N79R mutant of N-acetylornithine aminotransferase
Class: transferase
Keywords: PLP dependent fold type I sub class II aminotransferase, Transferase
Deposited on 2013-02-27, released 2014-03-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-10, with a file datestamp of 2017-05-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetylornithine/succinyldiaminopimelate aminotransferase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: argD, dapC, dtu, STM3468
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40732 (Start-419)
      • engineered mutation (93)
      • engineered mutation (312)
    Domains in SCOPe 2.07: d4jf0a_
  • Chain 'B':
    Compound: Acetylornithine/succinyldiaminopimelate aminotransferase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: argD, dapC, dtu, STM3468
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40732 (Start-419)
      • engineered mutation (93)
      • engineered mutation (312)
    Domains in SCOPe 2.07: d4jf0b_
  • Heterogens: EDO, ACT, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jf0A (A:)
    mrgshhhhhhgmashmateqtaitratfdevilpvyapadfipvkgkgsrvwdqqgkeyi
    dfaggiavtalghchpalvealksqgetlwhtsrvftnepalrlgrklidatfaervlfm
    nsgteanetafklarhyacvrhspfktkiiafhnafhgrslftvsvggqpkysdgfgpkp
    adiihvpfndlhavkavmddhtcavvvepiqgeggvqaatpeflkglrdlcdehqallvf
    devqcgmgrtgdlfaymhygvtpdiltsakalgggfpvsamlttqeiasafhvgshgsty
    ggnplacavagatfdiintpevlqgihtkrqqfvqhlqaideqfdifsdirgmglligae
    lkpkykgrardflyagaeagvmvlnagadvmrfapslvveeadihegmqrfaqavgkvva
    le
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jf0A (A:)
    adfipvkgkgsrvwdqqgkeyidfaggiavtalghchpalvealksqgetlwhtsrvftn
    epalrlgrklidatfaervlfmnsgteanetafklarhyacvrhspfktkiiafhnafhg
    rslftvsvggqpkysdgfgpkpadiihvpfndlhavkavmddhtcavvvepiqgeggvqa
    atpeflkglrdlcdehqallvfdevqcgmgrtgdlfaymhygvtpdiltsakalgggfpv
    samlttqeiasafhhgstyggnplacavagatfdiintpevlqgihtkrqqfvqhlqaid
    eqfdifsdirgmglligaelkpkykgrardflyagaeagvmvlnagadvmrfapslvvee
    adihegmqrfaqavgkvva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jf0B (B:)
    mrgshhhhhhgmashmateqtaitratfdevilpvyapadfipvkgkgsrvwdqqgkeyi
    dfaggiavtalghchpalvealksqgetlwhtsrvftnepalrlgrklidatfaervlfm
    nsgteanetafklarhyacvrhspfktkiiafhnafhgrslftvsvggqpkysdgfgpkp
    adiihvpfndlhavkavmddhtcavvvepiqgeggvqaatpeflkglrdlcdehqallvf
    devqcgmgrtgdlfaymhygvtpdiltsakalgggfpvsamlttqeiasafhvgshgsty
    ggnplacavagatfdiintpevlqgihtkrqqfvqhlqaideqfdifsdirgmglligae
    lkpkykgrardflyagaeagvmvlnagadvmrfapslvveeadihegmqrfaqavgkvva
    le
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jf0B (B:)
    lpvyapadfipvkgkgsrvwdqqgkeyidfaggiavtalghchpalvealksqgetlwht
    srvftnepalrlgrklidatfaervlfmnsgteanetafklarhyacvrhspfktkiiaf
    hnafhgrslftvsvggqpkysdgfgpkpadiihvpfndlhavkavmddhtcavvvepiqg
    eggvqaatpeflkglrdlcdehqallvfdevqcgmgrtgdlfaymhygvtpdiltsakal
    gggfpvsamlttqeiasafgstyggnplacavagatfdiintpevlqgihtkrqqfvqhl
    qaideqfdifsdirgmglligaelkpkykgrardflyagaeagvmvlnagadvmrfapsl
    vveeadihegmqrfaqavgkvva