PDB entry 4jex

View 4jex on RCSB PDB site
Description: Y21K mutant of N-acetylornithine aminotransferase complexed with L-canaline
Class: transferase
Keywords: PLP dependent fold type I sub class II aminotransferase, Transferase
Deposited on 2013-02-27, released 2014-03-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.157
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetylornithine/succinyldiaminopimelate aminotransferase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: argD, dapC, dtu, STM3468
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40732 (Start-419)
      • engineered mutation (312)
      • expression tag (420)
    Domains in SCOPe 2.07: d4jexa1, d4jexa2
  • Chain 'B':
    Compound: Acetylornithine/succinyldiaminopimelate aminotransferase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: argD, dapC, dtu, STM3468
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40732 (Start-419)
      • engineered mutation (35)
      • engineered mutation (312)
    Domains in SCOPe 2.07: d4jexb_
  • Heterogens: EDO, ACT, P00, NA, TNF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jexA (A:)
    mrgshhhhhhgmashmateqtaitratfdevilpvkapadfipvkgkgsrvwdqqgkeyi
    dfaggiavtalghchpalvealksqgetlwhtsnvftnepalrlgrklidatfaervlfm
    nsgteanetafklarhyacvrhspfktkiiafhnafhgrslftvsvggqpkysdgfgpkp
    adiihvpfndlhavkavmddhtcavvvepiqgeggvqaatpeflkglrdlcdehqallvf
    devqcgmgrtgdlfaymhygvtpdiltsakalgggfpvsamlttqeiasafhvgshgsty
    ggnplacavagatfdiintpevlqgihtkrqqfvqhlqaideqfdifsdirgmglligae
    lkpkykgrardflyagaeagvmvlnagadvmrfapslvveeadihegmqrfaqavgkvva
    le
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jexA (A:)
    adfipvkgkgsrvwdqqgkeyidfaggiavtalghchpalvealksqgetlwhtsnvftn
    epalrlgrklidatfaervlfmnsgteanetafklarhyacvrhspfktkiiafhnafhg
    rslftvsvggqpkysdgfgpkpadiihvpfndlhavkavmddhtcavvvepiqgeggvqa
    atpeflkglrdlcdehqallvfdevqcgmgrtgdlfaymhygvtpdiltsakalgggfpv
    samlttqeiasafgstyggnplacavagatfdiintpevlqgihtkrqqfvqhlqaideq
    fdifsdirgmglligaelkpkykgrardflyagaeagvmvlnagadvmrfapslvveead
    ihegmqrfaqavgkvval
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jexB (B:)
    mrgshhhhhhgmashmateqtaitratfdevilpvkapadfipvkgkgsrvwdqqgkeyi
    dfaggiavtalghchpalvealksqgetlwhtsnvftnepalrlgrklidatfaervlfm
    nsgteanetafklarhyacvrhspfktkiiafhnafhgrslftvsvggqpkysdgfgpkp
    adiihvpfndlhavkavmddhtcavvvepiqgeggvqaatpeflkglrdlcdehqallvf
    devqcgmgrtgdlfaymhygvtpdiltsakalgggfpvsamlttqeiasafhvgshgsty
    ggnplacavagatfdiintpevlqgihtkrqqfvqhlqaideqfdifsdirgmglligae
    lkpkykgrardflyagaeagvmvlnagadvmrfapslvveeadihegmqrfaqavgkvva
    le
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jexB (B:)
    lpvkapadfipvkgkgsrvwdqqgkeyidfaggiavtalghchpalvealksqgetlwht
    snvftnepalrlgrklidatfaervlfmnsgteanetafklarhyacvrhspfktkiiaf
    hnafhgrslftvsvggqpkysdgfgpkpadiihvpfndlhavkavmddhtcavvvepiqg
    eggvqaatpeflkglrdlcdehqallvfdevqcgmgrtgdlfaymhygvtpdiltsakal
    gggfpvsamlttqeiasafgstyggnplacavagatfdiintpevlqgihtkrqqfvqhl
    qaideqfdifsdirgmglligaelkpkykgrardflyagaeagvmvlnagadvmrfapsl
    vveeadihegmqrfaqavgkvva