PDB entry 4jeq

View 4jeq on RCSB PDB site
Description: Different Contribution of Conserved Amino Acids to the Global Properties of Homologous Enzymes
Class: isomerase
Keywords: tim barrel, isomerase, disease mutation, pentose shunt, gluconeogenesis, glycolysis
Deposited on 2013-02-27, released 2013-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (0-249)
      • engineered mutation (103)
    Domains in SCOPe 2.06: d4jeqa_
  • Chain 'B':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (0-249)
      • engineered mutation (103)
    Domains in SCOPe 2.06: d4jeqb_
  • Chain 'C':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (0-249)
      • engineered mutation (103)
    Domains in SCOPe 2.06: d4jeqc_
  • Chain 'D':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (0-249)
      • engineered mutation (103)
    Domains in SCOPe 2.06: d4jeqd_
  • Chain 'E':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (0-249)
      • engineered mutation (103)
    Domains in SCOPe 2.06: d4jeqe_
  • Chain 'F':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (0-249)
      • engineered mutation (103)
    Domains in SCOPe 2.06: d4jeqf_
  • Chain 'G':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (0-249)
      • engineered mutation (103)
    Domains in SCOPe 2.06: d4jeqg_
  • Chain 'H':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (Start-249)
      • engineered mutation (103)
    Domains in SCOPe 2.06: d4jeqh_
  • Chain 'I':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (0-249)
      • engineered mutation (103)
    Domains in SCOPe 2.06: d4jeqi_
  • Chain 'J':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (0-249)
      • engineered mutation (103)
    Domains in SCOPe 2.06: d4jeqj_
  • Chain 'K':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (0-249)
      • engineered mutation (103)
    Domains in SCOPe 2.06: d4jeqk_
  • Chain 'L':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (0-249)
      • engineered mutation (103)
    Domains in SCOPe 2.06: d4jeql_
  • Heterogens: SO4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jeqA (A:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
    qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jeqB (B:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
    qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jeqB (B:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaiatpqqaqe
    ahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdi
    ikatq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4jeqC (C:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
    qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jeqC (C:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigkvatpqq
    aqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpef
    vdiikatq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jeqD (D:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
    qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jeqE (E:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
    qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4jeqF (F:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
    qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jeqF (F:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaiggkvatpq
    qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
    fvdiikatq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4jeqG (G:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
    qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jeqG (G:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwavatpqqaqe
    ahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdi
    ikatq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4jeqH (H:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
    qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jeqH (H:)
    skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
    iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasgf
    mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaatpqqaqeah
    alirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiik
    atq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4jeqI (I:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
    qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jeqI (I:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwagkvatpqqa
    qeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefv
    diikatq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4jeqJ (J:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
    qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jeqJ (J:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaiggkvatpq
    qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
    fvdiikatq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4jeqK (K:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
    qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jeqK (K:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaivatpqqaq
    eahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvd
    iikatq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4jeqL (L:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatp
    qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jeqL (L:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygdtneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwakvatpqqaq
    eahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvd
    iikatq