PDB entry 4jei

View 4jei on RCSB PDB site
Description: Nonglycosylated Yarrowia lipolytica LIP2 lipase
Class: hydrolase
Keywords: alpha beta hydrolase fold, lipolytic enzyme, HYDROLASE
Deposited on 2013-02-27, released 2013-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-13, with a file datestamp of 2013-03-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.225
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipase 2
    Species: Yarrowia lipolytica [TaxId:4952]
    Gene: LIP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot E0A7J0
      • see remark 999 (87)
      • see remark 999 (95)
      • engineered mutation (112)
      • engineered mutation (133)
    Domains in SCOPe 2.07: d4jeia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jeiA (A:)
    vytstetshidqesynffekyarlanigycvgpgtkifkpfncglqcahfpnvelieefh
    dprlifdvsgylavdhaskqiylvirgthsledvitdirimqapltnfdlaaqisstatc
    ddclvhngfiqsyqntynqigpkldsvieqypdyqiavtghslggaaallfginlkvngh
    dplvvtlgqpivgnagfanwvdklffgqenpdvskvskdrklyrithrgdivpqvpfwdg
    yqhcsgevfidwplihpplsnvvmcqgqsnkqcsagntllqqvnvignhlqyfvtegvcg
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jeiA (A:)
    ytstetshidqesynffekyarlanigycvgpgtkifkpfncglqcahfpnvelieefhd
    prlifdvsgylavdhaskqiylvirgthsledvitdirimqapltnfdlaaqisstatcd
    dclvhngfiqsyqntynqigpkldsvieqypdyqiavtghslggaaallfginlkvnghd
    plvvtlgqpivgnagfanwvdklffgqenpdvskvskdrklyrithrgdivpqvpfwdgy
    qhcsgevfidwplihpplsnvvmcqgqsnkqcsagntllqqvnvignhlqyfvtegvcg