PDB entry 4jea

View 4jea on RCSB PDB site
Description: Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide bonds
Class: electron transport
Keywords: four-helix bundle, ELECTRON TRANSPORT
Deposited on 2013-02-26, released 2013-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: 0.134
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (80)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d4jeaa_
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (80)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d4jeab_
  • Chain 'C':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (80)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d4jeac_
  • Chain 'D':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (80)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d4jead_
  • Heterogens: HEM, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jeaA (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlancgkvkeaqaaaeqlkctcnachqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jeaB (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlancgkvkeaqaaaeqlkctcnachqkyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jeaC (C:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlancgkvkeaqaaaeqlkctcnachqkyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jeaD (D:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlancgkvkeaqaaaeqlkctcnachqkyr