PDB entry 4je4

View 4je4 on RCSB PDB site
Description: Crystal Structure of Monobody NSa1/SHP2 N-SH2 Domain Complex
Class: Signaling protein/protein binding
Keywords: engineered binding protein, SHP2 SH2-monobody complex, Phosphatase, Phosphotyrosine Binding, Phosphorylation, Signaling protein-protein binding complex
Deposited on 2013-02-26, released 2013-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.206
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTP2C, PTPN11, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124 (Start-102)
      • expression tag (103)
    Domains in SCOPe 2.07: d4je4a1, d4je4a2
  • Chain 'B':
    Compound: Monobody NSa1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JE4 (Start-93)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4je4A (A:)
    mtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntg
    dyydlyggekfatlaelvqyymehhgqlkekngdvielkyplnkek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4je4A (A:)
    srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
    ydlyggekfatlaelvqyymehhgqlkekngdvielkyplnk
    

  • Chain 'B':
    No sequence available.