PDB entry 4jds

View 4jds on RCSB PDB site
Description: SETD7 in complex with inhibitor PF-5426 and S-adenosyl-methionine
Class: transferase/transferase inhibitor
Keywords: SETD7, SAM, PF-5426, Structural Genomics Consortium, SGC, Methyltransferase, SET domain, histone modification, transcription regulation, histone lysine methyltransferase, inhibitor, S-adenosyl-L-methionine, transferase-transferase inhibitor complex
Deposited on 2013-02-25, released 2013-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.199
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-lysine N-methyltransferase SETD7
    Species: Homo sapiens [TaxId:9606]
    Gene: SETD7, KIAA1717, KMT7, SET7, SET9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WTS6 (Start-257)
      • expression tag (258-260)
    Domains in SCOPe 2.07: d4jdsa1, d4jdsa2, d4jdsa3
  • Chain 'B':
    Compound: Histone-lysine N-methyltransferase SETD7
    Species: Homo sapiens [TaxId:9606]
    Gene: SETD7, KIAA1717, KMT7, SET7, SET9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WTS6 (Start-257)
      • expression tag (258-259)
    Domains in SCOPe 2.07: d4jdsb1, d4jdsb2, d4jdsb3
  • Chain 'C':
    Compound: Histone-lysine N-methyltransferase SETD7
    Species: Homo sapiens [TaxId:9606]
    Gene: SETD7, KIAA1717, KMT7, SET7, SET9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WTS6 (Start-257)
      • expression tag (258-261)
    Domains in SCOPe 2.07: d4jdsc1, d4jdsc2, d4jdsc3
  • Chain 'D':
    Compound: Histone-lysine N-methyltransferase SETD7
    Species: Homo sapiens [TaxId:9606]
    Gene: SETD7, KIAA1717, KMT7, SET7, SET9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WTS6 (Start-257)
      • expression tag (258-260)
    Domains in SCOPe 2.07: d4jdsd1, d4jdsd2, d4jdsd3
  • Heterogens: SAM, 1L4, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jdsA (A:)
    qykdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegk
    latlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissage
    glfskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskyc
    aslghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgpe
    apewyqvelkafqatqqkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jdsA (A:)
    hgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmst
    eegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskva
    vgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycaslghka
    nhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydeapewyqvelkafqatq
    qkhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jdsB (B:)
    qykdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegk
    latlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissage
    glfskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskyc
    aslghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgpe
    apewyqvelkafqatqqkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jdsB (B:)
    gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste
    egrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskvav
    gpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycaslghkan
    hsftpnciydmfvhprfgpikcirtlraveadeeltvaygydeapewyqvelkafqatqq
    khh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4jdsC (C:)
    qykdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegk
    latlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissage
    glfskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskyc
    aslghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgpe
    apewyqvelkafqatqqkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jdsC (C:)
    gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste
    egrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskvav
    gpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycaslghkan
    hsftpnciydmfvhprfgpikcirtlraveadeeltvaygydeapewyqvelkafqatqq
    khhhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4jdsD (D:)
    qykdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegk
    latlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissage
    glfskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskyc
    aslghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgpe
    apewyqvelkafqatqqkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jdsD (D:)
    hgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmst
    eegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskva
    vgpntvmsfyngvrithqevdsrdalngntlsldeetvidvpepynhvskycaslghkan
    hsftpnciydmfvhprfgpikcirtlraveadeeltvaygydeapewyqvelkafqatqq
    khhh