PDB entry 4jdp

View 4jdp on RCSB PDB site
Description: Crystal structure of probable p-nitrophenyl phosphatase (pho2) (target EFI-501307) from Archaeoglobus fulgidus DSM 4304 with Magnesium bound
Class: hydrolase
Keywords: HYDROLASE, MAGNESIUM BINDING, STRUCTURAL GENOMICS, ENZYME Function INITIATIVE (EFI)
Deposited on 2013-02-25, released 2013-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.171
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p-nitrophenyl phosphatase (Pho2)
    Species: Archaeoglobus fulgidus [TaxId:224325]
    Gene: AF_0374
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jdpa_
  • Chain 'B':
    Compound: p-nitrophenyl phosphatase (Pho2)
    Species: Archaeoglobus fulgidus [TaxId:224325]
    Gene: AF_0374
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29873 (22-End)
      • expression tag (20-21)
    Domains in SCOPe 2.07: d4jdpb1, d4jdpb2
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jdpA (A:)
    mhhhhhhssgvdlgtenlyfqsmmpdkkgyiididgvigksvtpipegvegvkklkelgk
    kiifvsnnstrsrrillerlrsfglevgedeilvatyatarfiarekpnakvfttgeegl
    ieelrlagleivdydeaeylvvgsnrkinfelmtkalraclrgiryiatnpdrifpaedg
    pipgtgmiigalywmtgrepdvvvgkpsevimrealdilgldakdvavvgdqidvdvaag
    kaigaetvlvltgvttrenldqmierhglkpdyvfnslkdmvealeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jdpA (A:)
    mmpdkkgyiididgvigksvtpipegvegvkklkelgkkiifvsnnstrsrrillerlrs
    fglevgedeilvatyatarfiarekpnakvfttgeeglieelrlagleivdydeaeylvv
    gsnrkinfelmtkalraclrgiryiatnpdrifpaedgpipgtgmiigalywmtgrepdv
    vvgkpsevimrealdilgldakdvavvgdqidvdvaagkaigaetvlvltgvttrenldq
    mierhglkpdyvfnslkdmveale
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jdpB (B:)
    mhhhhhhssgvdlgtenlyfqsmmpdkkgyiididgvigksvtpipegvegvkklkelgk
    kiifvsnnstrsrrillerlrsfglevgedeilvatyatarfiarekpnakvfttgeegl
    ieelrlagleivdydeaeylvvgsnrkinfelmtkalraclrgiryiatnpdrifpaedg
    pipgtgmiigalywmtgrepdvvvgkpsevimrealdilgldakdvavvgdqidvdvaag
    kaigaetvlvltgvttrenldqmierhglkpdyvfnslkdmvealeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jdpB (B:)
    qsmmpdkkgyiididgvigksvtpipegvegvkklkelgkkiifvsnnstrsrrillerl
    rsfglevgedeilvatyatarfiarekpnakvfttgeeglieelrlagleivdydeaeyl
    vvgsnrkinfelmtkalraclrgiryiatnpdrifpaedgpipgtgmiigalywmtgrep
    dvvvgkpsevimrealdilgldakdvavvgdqidvdvaagkaigaetvlvltgvttrenl
    dqmierhglkpdyvfnslkdmveal