PDB entry 4jcs

View 4jcs on RCSB PDB site
Description: Crystal structure of Enoyl-CoA hydratase/isomerase from Cupriavidus metallidurans CH34
Class: lyase
Keywords: PSI-Biology, Structural Genomics, New York Structural Genomics Research Consortium, NYSGRC, oxyanion hole, hydrotase, isomerase, ADP binding, LYASE
Deposited on 2013-02-22, released 2013-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-13, with a file datestamp of 2013-03-08.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.211
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-CoA hydratase/isomerase
    Species: Cupriavidus metallidurans [TaxId:266264]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1LBW6 (22-285)
      • expression tag (19-21)
    Domains in SCOPe 2.07: d4jcsa1, d4jcsa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jcsA (A:)
    mhhhhhhssgvdlgtenlyfqsmdtldfevvnnvgwirmnraakhnpfdaelradlmtvl
    ervrddadirvlvltshpgsfcaggnlhvlrdnldsgpaywqqriktglrfihdmlnlgr
    pviaavdgpafgagfalsltadivlasprarfsmaylrlglvpdlgalyllpravglqra
    kelmfstreldaeeahrlglvmevhesealeqrareiaeslvqaaptalaltkaalnvsl
    dsdeqtmfsleaasqaaafstkepraaieallskqpppfrgfprrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcsA (A:)
    fqsmdtldfevvnnvgwirmnraakhnpfdaelradlmtvlervrddadirvlvltshpg
    sfcanlhvlrdnldsgpaywqqriktglrfihdmlnlgrpviaavdgpafgagfalslta
    divlasprarfsmaylrlglvpdlgalyllpravglqrakelmfstreldaeeahrlglv
    mevhesealeqrareiaeslvqaaptalaltkaalnvsldsdeqtmfsleaasqaaafst
    kepraaieallskqpppfrgfprrs