PDB entry 4jcr

View 4jcr on RCSB PDB site
Description: ClpP1 N165D mutant from Listeria monocytogenes
Class: hydrolase
Keywords: Pathogenic bacteria, Virulence factor, regulation, CLP protease family, active catalytic triad, HYDROLASE
Deposited on 2013-02-22, released 2013-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.22
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Y7Y1 (Start-189)
      • engineered mutation (164)
    Domains in SCOPe 2.07: d4jcra_
  • Chain 'B':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Y7Y1 (Start-189)
      • engineered mutation (164)
    Domains in SCOPe 2.07: d4jcrb_
  • Chain 'C':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Y7Y1 (Start-189)
      • engineered mutation (164)
    Domains in SCOPe 2.07: d4jcrc_
  • Chain 'D':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Y7Y1 (Start-189)
      • engineered mutation (164)
    Domains in SCOPe 2.07: d4jcrd_
  • Chain 'E':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Y7Y1 (Start-189)
      • engineered mutation (164)
    Domains in SCOPe 2.07: d4jcre_
  • Chain 'F':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Y7Y1 (Start-189)
      • engineered mutation (164)
    Domains in SCOPe 2.07: d4jcrf_
  • Chain 'G':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Y7Y1 (Start-189)
      • engineered mutation (164)
    Domains in SCOPe 2.07: d4jcrg_
  • Chain 'H':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Y7Y1 (Start-189)
      • engineered mutation (164)
    Domains in SCOPe 2.07: d4jcrh_
  • Chain 'I':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Y7Y1 (Start-189)
      • engineered mutation (164)
    Domains in SCOPe 2.07: d4jcri_
  • Chain 'J':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Y7Y1 (Start-189)
      • engineered mutation (164)
    Domains in SCOPe 2.07: d4jcrj_
  • Chain 'K':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Y7Y1 (Start-189)
      • engineered mutation (164)
    Domains in SCOPe 2.07: d4jcrk_
  • Chain 'L':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Y7Y1 (Start-189)
      • engineered mutation (164)
    Domains in SCOPe 2.07: d4jcrl_
  • Chain 'M':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Y7Y1 (Start-189)
      • engineered mutation (164)
    Domains in SCOPe 2.07: d4jcrm_
  • Chain 'N':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Y7Y1 (Start-189)
      • engineered mutation (164)
    Domains in SCOPe 2.07: d4jcrn_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jcrA (A:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcrA (A:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpageieieakeiirm
    rerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivneiienrdglk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jcrB (B:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcrB (B:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpageieieakeiirm
    rerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivneiienrdglk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4jcrC (C:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcrC (C:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpageieieakeiirm
    rerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivneiienrdglk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4jcrD (D:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcrD (D:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpageieieakeiirm
    rerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivneiienrdglk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4jcrE (E:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcrE (E:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpageieieakeiirm
    rerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivneiienrdglk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4jcrF (F:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcrF (F:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpageieieakeiirm
    rerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivneiienrdglk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4jcrG (G:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcrG (G:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpageieieakeiirm
    rerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivneiienrdglk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4jcrH (H:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcrH (H:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpageieieakeiirm
    rerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivneiienrdglk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4jcrI (I:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcrI (I:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpageieieakeiirm
    rerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivneiienrdglk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4jcrJ (J:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcrJ (J:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpageieieakeiirm
    rerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivneiienrdglk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4jcrK (K:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcrK (K:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpageieieakeiirm
    rerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivneiienrdglk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4jcrL (L:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcrL (L:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpageieieakeiirm
    rerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivneiienrdglk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4jcrM (M:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcrM (M:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpageieieakeiirm
    rerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivneiienrdglk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4jcrN (N:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcrN (N:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpageieieakeiirm
    rerinrliaeatgqsyeqiskdtdrdfwlsvneakdygivneiienrdglk