PDB entry 4jcq

View 4jcq on RCSB PDB site
Description: ClpP1 from Listeria monocytogenes
Class: hydrolase
Keywords: Pathogenic bacteria, Virulence factor, regulation, CLP protease family, inactive catalytic triad, HYDROLASE
Deposited on 2013-02-22, released 2013-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqa_
  • Chain 'B':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqb_
  • Chain 'C':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqc_
  • Chain 'D':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqd_
  • Chain 'E':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqe_
  • Chain 'F':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqf_
  • Chain 'G':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqg_
  • Chain 'H':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqh_
  • Chain 'I':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqi_
  • Chain 'J':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqj_
  • Chain 'K':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqk_
  • Chain 'L':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcql_
  • Chain 'M':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqm_
  • Chain 'N':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqn_
  • Chain 'O':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqo_
  • Chain 'P':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqp_
  • Chain 'Q':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqq_
  • Chain 'R':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqr_
  • Chain 'S':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqs_
  • Chain 'T':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqt_
  • Chain 'U':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqu_
  • Chain 'V':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqv_
  • Chain 'W':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqw_
  • Chain 'X':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqx_
  • Chain 'Y':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqy_
  • Chain 'Z':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jcqz_
  • Chain 'a':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Listeria monocytogenes [TaxId:169963]
    Gene: clpP, lmo1138
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jcqA (A:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqA (A:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jcqB (B:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqB (B:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4jcqC (C:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqC (C:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4jcqD (D:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqD (D:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4jcqE (E:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqE (E:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4jcqF (F:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqF (F:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4jcqG (G:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqG (G:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4jcqH (H:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqH (H:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4jcqI (I:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqI (I:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4jcqJ (J:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqJ (J:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4jcqK (K:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqK (K:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4jcqL (L:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqL (L:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4jcqM (M:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqM (M:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4jcqN (N:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqN (N:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4jcqO (O:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqO (O:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4jcqP (P:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqP (P:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4jcqQ (Q:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqQ (Q:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4jcqR (R:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqR (R:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4jcqS (S:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqS (S:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4jcqT (T:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqT (T:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4jcqU (U:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqU (U:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4jcqV (V:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqV (V:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >4jcqW (W:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqW (W:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4jcqX (X:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqX (X:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >4jcqY (Y:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqY (Y:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >4jcqZ (Z:)
    maentknenitniltqklidtrtvliygeinqelaedvskqllllesisndpitifinsq
    gghveagdtihdmikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpag
    gvqgqsteieieakeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivn
    eiienrdglkmaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcqZ (Z:)
    iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd
    mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr
    erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.