PDB entry 4jc4

View 4jc4 on RCSB PDB site
Description: Crystal structure of Peptidyl-tRNA hydrolase from Pseudomonas aeruginosa at 2.25 angstrom resolution
Class: hydrolase
Keywords: Hydrolase
Deposited on 2013-02-21, released 2013-04-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.187
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-tRNA hydrolase
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA4672, pth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4jc4a_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4jc4A (A:)
mtavqlivglgnpgpeydqtrhnagalfverlahaqgvslvadrkyfglvgkfshqgkdv
rllipttymnrsgqsvaalagffriapdailvahdeldmppgvaklktggghgghnglrd
iiaqlgnqnsfhrlrlgighpghsslvsgyvlgraprseqelldtsidfalgvlpemlag
dwtramqklhsqka