PDB entry 4jbu

View 4jbu on RCSB PDB site
Description: 1.65A structure of the T3SS tip protein LcrV (G28-D322, C273S) from Yersinia pestis
Class: protein binding
Keywords: LcrV, T3SS, tip protein, Yersinia pestis, PROTEIN BINDING
Deposited on 2013-02-20, released 2013-05-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.179
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Virulence-associated V antigen
    Species: Yersinia pestis [TaxId:632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7U7 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d4jbua1, d4jbua2
  • Heterogens: PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jbuA (A:)
    ghmgssvleelvqlvkdknidisikydprkdsevfanrvitddiellkkilayflpedai
    lkgghydnqlqngikrvkeflesspntqwelrafmavmhfsltadridddilkvivdsmn
    hhgdarsklreelaeltaelkiysviqaeinkhlsssgtinihdksinlmdknlygytde
    eifkasaeykilekmpqttiqvdgsekkivsikdflgsenkrtgalgnlknsysynkdnn
    elshfattssdksrplndlvsqkttqlsditsrfnsaiealnrfiqkydsvmqrlldd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jbuA (A:)
    ghmgssvleelvqlvkdknidisikydprkdsevfanrvitddiellkkilayflpedai
    lkgghydnqlqngikrvkeflesspntqwelrafmavmhfsltadridddilkvivdsmn
    hhgdarsklreelaeltaelkiysviqaeinkhlsssgtinihdksinlmdknlygytde
    eifkasaeykilekmpqttiqvdgsekkivsikdflgsenkrtgalgnlknsysynlndl
    vsqkttqlsditsrfnsaiealnrfiqkydsvmqrl