PDB entry 4jbr

View 4jbr on RCSB PDB site
Description: tRNA-guanine transglycosylase Y330C mutant as covalently linked dimer in space group P6(5)22
Class: transferase
Keywords: covalent dimer, TIM-barrel, transferase, guanine, preQ1, tRNA
Deposited on 2013-02-20, released 2014-03-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-16, with a file datestamp of 2021-06-11.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA-guanine transglycosylase
    Species: Zymomonas mobilis subsp. mobilis [TaxId:264203]
    Gene: tgt, ZMO0363
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28720
      • see remark 999 (313)
      • engineered mutation (331)
    Domains in SCOPe 2.08: d4jbra_
  • Heterogens: ZN, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jbrA (A:)
    gsmveataqetdrprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpet
    vratgadiilgntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqs
    eegvtfkshldgsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrw
    akrsrdafdsrkeqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqd
    emfrvldfsvpmlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdg
    pinirnarfsedlkpldsechcavcqkwsracihhlirageilgamlmtehniafyqqlm
    qkirdsisegrfsqfaqdfraryfarns
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jbrA (A:)
    rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
    tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslsltkqseegvtfkshldgs
    rhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrke
    qaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpml
    pddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedl
    kpldsechcavcqkwsracihhlirageilgamlmtehniafyqqlmqkirdsisegrfs
    qfaqdfraryfarn