PDB entry 4jba

View 4jba on RCSB PDB site
Description: Crystal Structure of the Oxidized Form of MarR from E.coli
Class: transcription regulator
Keywords: disulfide bonds, transcription regulator, DNA, TRANSCRIPTION REGULATION
Deposited on 2013-02-19, released 2013-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.242
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: multiple antibiotic resistance protein marr
    Species: Escherichia coli [TaxId:83333]
    Gene: b1530, cfxB, inaR, JW5248, marR, soxQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27245 (Start-143)
      • conflict (46)
      • conflict (50)
      • conflict (53)
      • conflict (107)
      • conflict (110)
    Domains in SCOPe 2.08: d4jbaa_
  • Chain 'B':
    Compound: multiple antibiotic resistance protein marr
    Species: Escherichia coli [TaxId:83333]
    Gene: b1530, cfxB, inaR, JW5248, marR, soxQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27245 (Start-143)
      • conflict (46)
      • conflict (50)
      • conflict (53)
      • conflict (107)
      • conflict (110)
    Domains in SCOPe 2.08: d4jbab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jbaA (A:)
    mkstsdlfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlssirsaasitpvel
    kkvlsvdlgaltrmldrlvckgwverlpnpndkrgvlvklttggaaiseqshqlvgqdlh
    qeltknltadevatleyllkkvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jbaA (A:)
    lfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlssirsaasitpvelkkvlsv
    dlgaltrmldrlvckgwverlpnpnvlvklttggaaiseqshqlvgqdlhqeltknltad
    evatleyllkkvlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jbaB (B:)
    mkstsdlfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlssirsaasitpvel
    kkvlsvdlgaltrmldrlvckgwverlpnpndkrgvlvklttggaaiseqshqlvgqdlh
    qeltknltadevatleyllkkvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jbaB (B:)
    dlfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlssirsaasitpvelkkvls
    vdlgaltrmldrlvckgwverlpnpngvlvklttggaaiseqshqlvgqdlhqeltknlt
    adevatleyllkkvlp