PDB entry 4jb4

View 4jb4 on RCSB PDB site
Description: Expression, Purification, Characterization, and Solution NMR Study of Highly Deuterated Yeast Cytochrome c Peroxidase with Enhanced Solubility
Class: oxidoreductase
Keywords: Cytochrome c Peroxidase, OXIDOREDUCTASE
Deposited on 2013-02-19, released 2013-04-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.216
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: CCP1, CCP, CPO, YKR066C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jb4a_
  • Chain 'C':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: CCP1, CCP, CPO, YKR066C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jb4c_
  • Heterogens: HEM, F, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jb4A (A:)
    mktlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqglhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jb4A (A:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlk
    nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
    ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4jb4C (C:)
    mktlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqglhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jb4C (C:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlk
    nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
    ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl