PDB entry 4jaj

View 4jaj on RCSB PDB site
Description: Crystal Structure of Aurora Kinase A in complex with BENZO[C][1,8]NAPHTHYRIDIN-6(5H)-ONE
Class: transferase/transferase inhibitor
Keywords: KINASE INHIBITOR COMPLEX, ATP-BINDING, CELL CYCLE,CYTOPLASM, CYTOSKELETON, NUCLEOTIDE-BINDING,PHOSPHOPROTEIN, SERINE/THREONINE-PROTEIN KINASE, TRANSFERASE, Protein kinase-like Cytoplasm, transferase-transferase inhibitor complex
Deposited on 2013-02-18, released 2013-05-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.238
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jaja_
  • Heterogens: XU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jajA (A:)
    mhhhhhhggeskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqleka
    gvehqlrreveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqr
    tatyitelanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgt
    ldylppemiegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfv
    tegardlisrllkhnpsqrpmlrevlehpwitansskpsncqnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jajA (A:)
    krqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrevei
    qshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanal
    sychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegr
    mhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrll
    khnpsqrpmlrevlehpwitanssk