PDB entry 4jac

View 4jac on RCSB PDB site
Description: Dehaloperoxidase-Hemoglobin T56S
Class: oxidoreductase
Keywords: peroxidase, OXIDOREDUCTASE
Deposited on 2013-02-18, released 2013-11-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.185
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NAV8 (Start-137)
      • engineered mutation (56)
    Domains in SCOPe 2.04: d4jaca_
  • Chain 'B':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NAV8 (Start-137)
      • engineered mutation (56)
    Domains in SCOPe 2.04: d4jacb_
  • Heterogens: HEM, SO4, AZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jacA (A:)
    mgfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhsekv
    fnlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqs
    wdrfgknlvsalssagmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jacA (A:)
    gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhsekvf
    nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jacB (B:)
    mgfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhsekv
    fnlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqs
    wdrfgknlvsalssagmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jacB (B:)
    gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhsekvf
    nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk