PDB entry 4ja2

View 4ja2 on RCSB PDB site
Description: Structural basis of a rationally rewired protein-protein interface (RR468mutant V13P, L14I, I17M and N21V)
Class: signaling protein
Keywords: alpha/beta domain, signal propagation, catalysis of phosphotransfer, auto-dephosphorylation, Histidine kinase binding, Phosphorylation, SIGNALING PROTEIN
Deposited on 2013-02-18, released 2013-09-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.188
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM_0468
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYT9 (Start-121)
      • engineered mutation (12-13)
      • engineered mutation (16)
      • engineered mutation (20)
    Domains in SCOPe 2.03: d4ja2a_
  • Heterogens: MG, SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ja2A (A:)
    mskkvllvddsapirkmvsfvlkkegyevieaengqialeklseftpdlivldimmpvmd
    gftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhll
    ne
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ja2A (A:)
    skkvllvddsapirkmvsfvlkkegyevieaengqialeklseftpdlivldimmpvmdg
    ftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhlln
    e