PDB entry 4ja2

View 4ja2 on RCSB PDB site
Description: Structural basis of a rationally rewired protein-protein interface (RR468mutant V13P, L14I, I17M and N21V)
Class: signaling protein
Keywords: alpha/beta domain, signal propagation, catalysis of phosphotransfer, auto-dephosphorylation, Histidine kinase binding, Phosphorylation, SIGNALING PROTEIN
Deposited on 2013-02-18, released 2013-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.188
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Response regulator
  Species: THERMOTOGA MARITIMA [TaxId:243274]
  Gene: TM_0468
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WYT9 (Start-121)
    • engineered mutation (12-13)
    • engineered mutation (16)
    • engineered mutation (20)
  Domains in SCOPe 2.08: d4ja2a_
• Heterogens: MG, SO4, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4ja2A (A:)
  mskkvllvddsapirkmvsfvlkkegyevieaengqialeklseftpdlivldimmpvmd
  gftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhll
  ne
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4ja2A (A:)
  skkvllvddsapirkmvsfvlkkegyevieaengqialeklseftpdlivldimmpvmdg
  ftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhlln
  e