PDB entry 4j8t

View 4j8t on RCSB PDB site
Description: Engineered Digoxigenin binder DIG10.2
Class: digoxigenin binding protein
Keywords: engineered, computationally designed, Digoxigenin-binding, DIGOXIGENIN BINDING PROTEIN
Deposited on 2013-02-14, released 2013-06-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Engineered Digoxigenin binder protein DIG10.2
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA3332
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HYR3 (0-End)
      • engineered mutation (6)
      • engineered mutation (9)
      • engineered mutation (33)
      • engineered mutation (36)
      • engineered mutation (40)
      • engineered mutation (60-61)
      • engineered mutation (63)
      • engineered mutation (89)
      • engineered mutation (98)
      • engineered mutation (116)
      • engineered mutation (118)
      • engineered mutation (123)
      • engineered mutation (126)
    Domains in SCOPe 2.08: d4j8ta_
  • Chain 'B':
    Compound: Engineered Digoxigenin binder protein DIG10.2
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA3332
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HYR3
      • engineered mutation (6)
      • engineered mutation (9)
      • engineered mutation (33)
      • engineered mutation (36)
      • engineered mutation (40)
      • engineered mutation (60-61)
      • engineered mutation (63)
      • engineered mutation (89)
      • engineered mutation (98)
      • engineered mutation (116)
      • engineered mutation (118)
      • engineered mutation (123)
    Domains in SCOPe 2.08: d4j8tb_
  • Chain 'C':
    Compound: Engineered Digoxigenin binder protein DIG10.2
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA3332
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HYR3 (0-End)
      • engineered mutation (6)
      • engineered mutation (9)
      • engineered mutation (33)
      • engineered mutation (36)
      • engineered mutation (40)
      • engineered mutation (60-61)
      • engineered mutation (63)
      • engineered mutation (89)
      • engineered mutation (98)
      • engineered mutation (116)
      • engineered mutation (118)
      • engineered mutation (123)
    Domains in SCOPe 2.08: d4j8tc_
  • Chain 'D':
    Compound: Engineered Digoxigenin binder protein DIG10.2
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: PA3332
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HYR3 (0-End)
      • engineered mutation (6)
      • engineered mutation (9)
      • engineered mutation (33)
      • engineered mutation (36)
      • engineered mutation (40)
      • engineered mutation (60-61)
      • engineered mutation (63)
      • engineered mutation (89)
      • engineered mutation (98)
      • engineered mutation (116)
      • engineered mutation (118)
      • engineered mutation (123)
      • engineered mutation (126)
    Domains in SCOPe 2.08: d4j8td_
  • Heterogens: DOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j8tA (A:)
    mnakeivvhalrllengdargwcdlfhpegvleypypppgyktrfegretiwahmrlfpe
    ymtirftdvqfyetadpdlaigefhgdgvhtvsggklaadyisvlrtrdgqillyrlffn
    plrvleplglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j8tA (A:)
    mnakeivvhalrllengdargwcdlfhpegvleypypppgyktrfegretiwahmrlfpe
    ymtirftdvqfyetadpdlaigefhgdgvhtvsggklaadyisvlrtrdgqillyrlffn
    plrvlepl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4j8tB (B:)
    mnakeivvhalrllengdargwcdlfhpegvleypypppgyktrfegretiwahmrlfpe
    ymtirftdvqfyetadpdlaigefhgdgvhtvsggklaadyisvlrtrdgqillyrlffn
    plrvleplglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j8tB (B:)
    nakeivvhalrllengdargwcdlfhpegvleypypppgyktrfegretiwahmrlfpey
    mtirftdvqfyetadpdlaigefhgdgvhtvklaadyisvlrtrdgqillyrlffnplrv
    l
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4j8tC (C:)
    mnakeivvhalrllengdargwcdlfhpegvleypypppgyktrfegretiwahmrlfpe
    ymtirftdvqfyetadpdlaigefhgdgvhtvsggklaadyisvlrtrdgqillyrlffn
    plrvleplglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j8tC (C:)
    mnakeivvhalrllengdargwcdlfhpegvleypypppgyktrfegretiwahmrlfpe
    ymtirftdvqfyetadpdlaigefhgdgvhklaadyisvlrtrdgqillyrlffnplrvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4j8tD (D:)
    mnakeivvhalrllengdargwcdlfhpegvleypypppgyktrfegretiwahmrlfpe
    ymtirftdvqfyetadpdlaigefhgdgvhtvsggklaadyisvlrtrdgqillyrlffn
    plrvleplglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j8tD (D:)
    mnakeivvhalrllengdargwcdlfhpegvleypypppgyktrfegretiwahmrlfpe
    ymtirftdvqfyetadpdlaigefhgdgvhsggklaadyisvlrtrdgqillyrlffnpl
    rvlepl