PDB entry 4j8e

View 4j8e on RCSB PDB site
Description: Middle domain of Hsc70-interacting protein, crystal form I
Class: chaperone
Keywords: tetratricopeptide repeat, solenoid, Co-chaperone, cytosol, CHAPERONE
Deposited on 2013-02-14, released 2013-07-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.187
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hsc70-interacting protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fam10a1, Hip, St13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4j8ea_
  • Chain 'B':
    Compound: Hsc70-interacting protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fam10a1, Hip, St13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4j8eb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j8eA (A:)
    garggsdleidnegvieadtdapqemgdenaeiteammdeanekkgaaidalndgelqka
    idlftdaiklnprlailyakrasvfvklqkpnaairdcdraieinpdsaqpykwrgkahr
    llghweeaardlalackldydedasamlrevqpraqkiaehrrkyerkreereik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j8eA (A:)
    apqemgdenaeiteammdeanekkgaaidalndgelqkaidlftdaiklnprlailyakr
    asvfvklqkpnaairdcdraieinpdsaqpykwrgkahrllghweeaardlalackldy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4j8eB (B:)
    garggsdleidnegvieadtdapqemgdenaeiteammdeanekkgaaidalndgelqka
    idlftdaiklnprlailyakrasvfvklqkpnaairdcdraieinpdsaqpykwrgkahr
    llghweeaardlalackldydedasamlrevqpraqkiaehrrkyerkreereik
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j8eB (B:)
    pqemgdenaeiteammdeanekkgaaidalndgelqkaidlftdaiklnprlailyakra
    svfvklqkpnaairdcdraieinpdsaqpykwrgkahrllghweeaardlalackldyd