PDB entry 4j7x

View 4j7x on RCSB PDB site
Description: Crystal structure of human sepiapterin reductase in complex with sulfasalazine
Class: oxidoreductase
Keywords: Reductase, OXIDOREDUCTASE
Deposited on 2013-02-14, released 2014-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.219
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j7xa_
  • Chain 'B':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j7xb_
  • Chain 'F':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j7xf_
  • Chain 'J':
    Compound: sepiapterin reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: SPR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j7xj_
  • Heterogens: NAP, SO4, SAS, PEG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j7xA (A:)
    msyyhhhhhhlestslykkaglegvrtmegglgravclltgasrgfgrtlapllasllsp
    gsvlvlsarndealrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglq
    rlllinnagslgdvskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvv
    nisslcalqpfkgwalycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlarets
    vdpdmrkglqelkakgklvdckvsaqkllsllekdefksgahvdfydk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j7xA (A:)
    glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv
    vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
    walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
    laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
    llekdefksgahvdfyd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4j7xB (B:)
    msyyhhhhhhlestslykkaglegvrtmegglgravclltgasrgfgrtlapllasllsp
    gsvlvlsarndealrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglq
    rlllinnagslgdvskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvv
    nisslcalqpfkgwalycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlarets
    vdpdmrkglqelkakgklvdckvsaqkllsllekdefksgahvdfydk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j7xB (B:)
    glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv
    vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
    walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
    laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
    llekdefksgahvdfyd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4j7xF (F:)
    msyyhhhhhhlestslykkaglegvrtmegglgravclltgasrgfgrtlapllasllsp
    gsvlvlsarndealrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglq
    rlllinnagslgdvskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvv
    nisslcalqpfkgwalycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlarets
    vdpdmrkglqelkakgklvdckvsaqkllsllekdefksgahvdfydk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j7xF (F:)
    glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv
    vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
    walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
    laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
    llekdefksgahvdfyd
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4j7xJ (J:)
    msyyhhhhhhlestslykkaglegvrtmegglgravclltgasrgfgrtlapllasllsp
    gsvlvlsarndealrqleaelgaersglrvvrvpadlgaeaglqqllgalrelprpkglq
    rlllinnagslgdvskgfvdlsdstqvnnywalnltsmlcltssvlkafpdspglnrtvv
    nisslcalqpfkgwalycagkaardmlfqvlaleepnvrvlnyapgpldtdmqqlarets
    vdpdmrkglqelkakgklvdckvsaqkllsllekdefksgahvdfydk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j7xJ (J:)
    glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv
    vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
    walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
    laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
    llekdefksgahvdfyd