PDB entry 4j6r

View 4j6r on RCSB PDB site
Description: Crystal structure of broadly and potently neutralizing antibody VRC23 in complex with HIV-1 gp120
Class: viral protein/immune system
Keywords: HIV, GP120, CD4-binding site, VRC23, NEUTRALIZATION, VACCINE, Antibody, envelope protein, immune system, viral protein-immune system complex
Deposited on 2013-02-11, released 2013-05-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.165
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: envelope glycoprotein gp160
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 4J6R (0-358)
  • Chain 'H':
    Compound: heavy chain of antibody vrc23
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4J6R (0-End)
  • Chain 'L':
    Compound: light chain of antibody vrc23
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4J6R (0-209)
    Domains in SCOPe 2.05: d4j6rl1, d4j6rl2
  • Heterogens: NAG, CA, EDO, MPD, TRS, BU3, HOH

PDB Chain Sequences:

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4j6rL (L:)
eivmtqspvtvsvsrggtatlscrasqgvgsdvawyqhkpgqtprlliygastrasgvpe
rfsgsgfhvdftlsisglqpedvaiyycqqyetfgqgtkveikrtvaapsvfifppsdeq
lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
dyekhkvyacevthqglsspvtksfnrgec