PDB entry 4j6d

View 4j6d on RCSB PDB site
Description: The 2.4 A crystal structure of CYP154C5 from Nocardia farcinica in complex with testosterone
Class: oxidoreductase/substrate
Keywords: Cytochrom P450, steroid hydroxylating monooxygenase, steroid binding, oxidoreductase-substrate complex
Deposited on 2013-02-11, released 2014-03-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.184
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 monooxygenase
    Species: NOCARDIA FARCINICA [TaxId:247156]
    Gene: NFA_53110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4j6da_
  • Chain 'B':
    Compound: cytochrome p450 monooxygenase
    Species: NOCARDIA FARCINICA [TaxId:247156]
    Gene: NFA_53110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4j6db_
  • Heterogens: HEM, MG, TES, FMT, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j6dA (A:)
    mnacphsdtltidpmitdlagetsrlraagpltridllgvpalavtghtlarqlltdtrl
    vkdinawslwqsgtvtrqwpligmidvdrsmftvdgpehrrlrikttqaltrrrldalkp
    tieryvaellddleragadgavvdlksvfayplpmrvisalmgvpsedqeqlltwykaff
    siltpqderlrvidemhgyftemvrrktaepgddltsaliyatdgetplteeevignlqa
    lvaaghettvsliltavrallshpeqlrlvrdgeigwetaieetlrwdgpvihllmrfat
    edidlgdaviprgegvvmsyraigrditvhgadaddfditrataarhisfghgphicpga
    alarleaaialpalftrfphlhpalpldqipnlpvltqndlshfpihlgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j6dA (A:)
    cphsdtltidpmitdlagetsrlraagpltridllgvpalavtghtlarqlltdtrlvkd
    inawslwqsgtvtrqwpligmidvdrsmftvdgpehrrlrikttqaltrrrldalkptie
    ryvaellddleragadgavvdlksvfayplpmrvisalmgvpsedqeqlltwykaffsil
    tpqderlrvidemhgyftemvrrktaepgddltsaliyatdgetplteeevignlqalva
    aghettvsliltavrallshpeqlrlvrdgeigwetaieetlrwdgpvihllmrfatedi
    dlgdaviprgegvvmsyraigrditvhgadaddfditrataarhisfghgphicpgaala
    rleaaialpalftrfphlhpalpldqipnlpvltqndlshfpihlgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4j6dB (B:)
    mnacphsdtltidpmitdlagetsrlraagpltridllgvpalavtghtlarqlltdtrl
    vkdinawslwqsgtvtrqwpligmidvdrsmftvdgpehrrlrikttqaltrrrldalkp
    tieryvaellddleragadgavvdlksvfayplpmrvisalmgvpsedqeqlltwykaff
    siltpqderlrvidemhgyftemvrrktaepgddltsaliyatdgetplteeevignlqa
    lvaaghettvsliltavrallshpeqlrlvrdgeigwetaieetlrwdgpvihllmrfat
    edidlgdaviprgegvvmsyraigrditvhgadaddfditrataarhisfghgphicpga
    alarleaaialpalftrfphlhpalpldqipnlpvltqndlshfpihlgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j6dB (B:)
    cphsdtltidpmitdlagetsrlraagpltridllgvpalavtghtlarqlltdtrlvkd
    inawslwqsgtvtrqwpligmidvdrsmftvdgpehrrlrikttqaltrrrldalkptie
    ryvaellddleragadgavvdlksvfayplpmrvisalmgvpsedqeqlltwykaffsil
    tpqderlrvidemhgyftemvrrktaepgddltsaliyadgetplteeevignlqalvaa
    ghettvsliltavrallshpeqlrlvrdgeigwetaieetlrwdgpvihllmrfatedid
    lgdaviprgegvvmsyraigrditvhgadaddfditrataarhisfghgphicpgaalar
    leaaialpalftrfphlhpalpldqipnlpvltqndlshfpihlgr