PDB entry 4j6c

View 4j6c on RCSB PDB site
Description: The 1.9 A crystal structure of CYP154C5 from Nocardia farcinica in complex with progesterone
Class: oxidoreductase/substrate
Keywords: Cytochrom P450, steroid hydroxylating monooxygenase, steroid binding, oxidoreductase-substrate complex
Deposited on 2013-02-11, released 2014-03-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 monooxygenase
    Species: NOCARDIA FARCINICA [TaxId:247156]
    Gene: NFA_53110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4j6ca_
  • Chain 'B':
    Compound: cytochrome p450 monooxygenase
    Species: NOCARDIA FARCINICA [TaxId:247156]
    Gene: NFA_53110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4j6cb_
  • Heterogens: STR, HEM, MG, FMT, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j6cA (A:)
    mnacphsdtltidpmitdlagetsrlraagpltridllgvpalavtghtlarqlltdtrl
    vkdinawslwqsgtvtrqwpligmidvdrsmftvdgpehrrlrikttqaltrrrldalkp
    tieryvaellddleragadgavvdlksvfayplpmrvisalmgvpsedqeqlltwykaff
    siltpqderlrvidemhgyftemvrrktaepgddltsaliyatdgetplteeevignlqa
    lvaaghettvsliltavrallshpeqlrlvrdgeigwetaieetlrwdgpvihllmrfat
    edidlgdaviprgegvvmsyraigrditvhgadaddfditrataarhisfghgphicpga
    alarleaaialpalftrfphlhpalpldqipnlpvltqndlshfpihlgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j6cA (A:)
    cphsdtltidpmitdlagetsrlraagpltridllgvpalavtghtlarqlltdtrlvkd
    inawslwqsgtvtrqwpligmidvdrsmftvdgpehrrlrikttqaltrrrldalkptie
    ryvaellddleragadgavvdlksvfayplpmrvisalmgvpsedqeqlltwykaffsil
    tpqderlrvidemhgyftemvrrktaepgddltsaliyatdgetplteeevignlqalva
    aghettvsliltavrallshpeqlrlvrdgeigwetaieetlrwdgpvihllmrfatedi
    dlgdaviprgegvvmsyraigrditvhgadaddfditrataarhisfghgphicpgaala
    rleaaialpalftrfphlhpalpldqipnlpvltqndlshfpihlgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4j6cB (B:)
    mnacphsdtltidpmitdlagetsrlraagpltridllgvpalavtghtlarqlltdtrl
    vkdinawslwqsgtvtrqwpligmidvdrsmftvdgpehrrlrikttqaltrrrldalkp
    tieryvaellddleragadgavvdlksvfayplpmrvisalmgvpsedqeqlltwykaff
    siltpqderlrvidemhgyftemvrrktaepgddltsaliyatdgetplteeevignlqa
    lvaaghettvsliltavrallshpeqlrlvrdgeigwetaieetlrwdgpvihllmrfat
    edidlgdaviprgegvvmsyraigrditvhgadaddfditrataarhisfghgphicpga
    alarleaaialpalftrfphlhpalpldqipnlpvltqndlshfpihlgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j6cB (B:)
    phsdtltidpmitdlagetsrlraagpltridllgvpalavtghtlarqlltdtrlvkdi
    nawslwqsgtvtrqwpligmidvdrsmftvdgpehrrlrikttqaltrrrldalkptier
    yvaellddleragadgavvdlksvfayplpmrvisalmgvpsedqeqlltwykaffsilt
    pqderlrvidemhgyftemvrrktaepgddltsaliyatdgetplteeevignlqalvaa
    ghettvsliltavrallshpeqlrlvrdgeigwetaieetlrwdgpvihllmrfatedid
    lgdaviprgegvvmsyraigrditvhgadaddfditrataarhisfghgphicpgaalar
    leaaialpalftrfphlhpalpldqipnlpvltqndlshfpihlgr