PDB entry 4j62

View 4j62 on RCSB PDB site
Description: Crystal structure of Ribonuclease A soaked in 40% Cyclohexanol: One of twelve in MSCS set
Class: hydrolase
Keywords: Endoribonuclease, HYDROLASE
Deposited on 2013-02-11, released 2014-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease pancreatic
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-123)
  Domains in SCOPe 2.07: d4j62a_
• Heterogens: SO4, CXL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4j62A (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv