PDB entry 4j5y

View 4j5y on RCSB PDB site
Description: Crystal structure of Hfq from Pseudomonas aeruginosa in complex with ATP
Class: RNA Binding protein
Keywords: LSM, RNA binding protein, RNA chaperone, sRNA, mRNA
Deposited on 2013-02-11, released 2013-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-21, with a file datestamp of 2013-08-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.188
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein hfq
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j5ya_
  • Chain 'B':
    Compound: Protein hfq
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j5yb_
  • Chain 'C':
    Compound: Protein hfq
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j5yc_
  • Chain 'D':
    Compound: Protein hfq
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j5yd_
  • Chain 'E':
    Compound: Protein hfq
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j5ye_
  • Chain 'F':
    Compound: Protein hfq
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: hfq, PA4944
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4j5yf_
  • Heterogens: ATP, NA, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j5yA (A:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j5yA (A:)
    ghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvv
    psrpvrlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4j5yB (B:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j5yB (B:)
    ghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvv
    psrpvrlp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4j5yC (C:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j5yC (C:)
    ghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvv
    psrpvrlp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4j5yD (D:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j5yD (D:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvrlps
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4j5yE (E:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j5yE (E:)
    ghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvv
    psrpvrlp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4j5yF (F:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j5yF (F:)
    kghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistv
    vpsrpvrlp